PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_05425.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 309aa    MW: 33816.4 Da    PI: 9.8751
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_05425.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.8e-382383262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             ++ +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  Rsa1.0_05425.1_g00002.1 23 PQPQLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVK 83
                             67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.3E-332681IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-272781IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9012781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MQSKNMSVAP SHQQPQQQQA HQPQPQLKCP RCDSSNTKFC YYNNYSLSQP RHFCKACKRY  60
WTRGGTLRNV PVGGSYRKNK RVKRKATATS TAASTASKTT SSSPNSRHHQ ISHFSSMNHH  120
PMFYGLSDHV SSCNSLPMIP SRFSDSSKTS SSGLESKFSS SGFSGLSSLG LGLPHHMSHD  180
HTINGGFINN STENKPFLLS GLFGSSVSLS SSSLLQNPHK PVNNGCEMMG QSHLQTLASL  240
QDFHVRENNE DVNKEGKLDQ ISGNNNGFMS PSSFDPSNYN NIWNNASVVN GAWLDPTNNN  300
VGSSLTSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593055.11e-170PREDICTED: dof zinc finger protein DOF1.4-like
RefseqXP_013692400.11e-170PREDICTED: dof zinc finger protein DOF1.4-like
RefseqXP_013692401.11e-170PREDICTED: dof zinc finger protein DOF1.4-like
SwissprotQ9FZA41e-147DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLA0A078JJD91e-170A0A078JJD9_BRANA; BnaCnng51540D protein
TrEMBLA0A0D3D6961e-170A0A0D3D696_BRAOL; Uncharacterized protein
STRINGBra030089.1-P1e-167(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-119Dof family protein